*Click on More INFO*
FREE SHIPPING from BeautyChoice.com!

FAQ:Is this better than the CHI?
Answer: It’s all going to depend on your preference. For me, I like both. I like the steam in this one though because it added just a little more shine to my hair, especially at the ends/tips. But the CHI works just as well.:)

Maxiglide XP Flat Iron

http://www.pntra.com/t/Rj9DREdFSD9DS0hCRz9IREpI?url=http%3A%2F%2Fwww.beautychoice.com%2Fproducts%2FMaxiglide_XP_Flat_Iron_2-11939-0.html

Maxius Beyond Straight Temporary Hair straightening product

http://www.pjtra.com/t/Rj9DREdFSD9DS0hCRz9IREpI?url=http%3A%2F%2Fwww.beautychoice.com%2Fproducts%2FMaxius_Beyond_Straight-5633-0.html

Flat Iron Product Description
This updated design of the Maxiglide flat iron boasts a sleek new look, automatic shut off and the revolutionary technology that made Maxiglide a national phenomenon. The Maxiglide XP flat iron delivers a powerful hair straightener that performs several key actions at once: detangling and fine combing hair; a patented Steam Burst System to soften even the most resistant hair for easy straightening; variable heat control and even extra flat plates included for quick touchups. Add to this a ceramic heater for negative ions to preserve hair structure and natural moisture, as well as an ergonomic design and rubber grip handle and the Maxiglide flat iron – a revolution in one step hair straightening – will get you through even the most hurried morning routines in a flash!

Maxiglide XP Flat Iron Features:
The design of the steam burst system, pins, channels and ceramic technology creates smooth, shiny, straight hair in minutes, without blowing hair smooth first.
Detangling pins feature smooth, rounded ends don’t harm the hair’s sensitive cuticle like bristles. You can completely detangle the hair to the very end at a rate of 0.3 millimeter (detangling property), like a fine comb.
Ceramic technology creates negative ions and distributes heat quickly to create a shiny, silky and smooth finish and help revitalize hair.
Plates are 2 inches wide and nearly 4 inches long, providing more room on the plate for a section of hair, which allows you to take wider section of hair, thus reducing the styling time. Perfect for long or unruly hair types!
The design of case features edges and corners that are curved, so you can see exactly where the iron is on your hair relative to your scalp
Steam S.B.S. (patented Steam Burst System) provides just the right amount of steam when you need it. A burst of steam smoothes out even the most frizzy, wavy hair steam and softens the stubborn hair just like steam in the iron softens the fabric making it easier to smooth.
Design of the case related to placement of pins and the protective/styling channels protect the scalp/skin from high temperatures and burn. The back and sides of the case stay cooler than on other irons.
Every outer pin on the plate is accurately lined-up with a corresponding channel, directing the hair through the ribs, allowing you to achieve flips and curves.
A BONUS flat plate is included for quick touch-ups.
Placement of the on-off switch is away from your hand, allowing you to only turn it on or off when you want to, not by accident.
Auto shut-off feature protects your iron, furniture, and peace of mind!
Variable heat control allows you to choose the temperature
110V, ALCI safety plug
Includes instructional video

Maxius Beyond Straight Product Description
Maxius Beyond Straight is a humidity resistant temporary straightener with wheat protein and thermal protection that allows you to go straight, reduce frizz and relax curls.
It can be used with a blow dryer alone or together with a flat iron for optimum control and added manageability.

Product Benefits:

A natural blend of matricaria, kiwi and henna adds conditioning
Humidity resistant
Great for everyday use
Cruelty free. No animal testing
Directions:

After shampooing, spread evenly from root to ends on wet hair. Use a blow dryer to heat activate during styling process.

Ingredients:

Water, Tocopheryl Acetate, Retinyl Palmitate, Panthenol, Chamomilla Recutita (Matricaria) Extract, Actinidia Chinensis (Kiwi) Fruit Extract, Lawsonia Inermis (Henna) Extract, Wheat Amino Acids, Hydrolyzed Wheat Protein/PVP Crosspolymer, Propylene Glycol, PEG-60 Almond Glycerides, Dimethicone Copolyol, Dimethicone, Polyquarternium-28, PVP/DMAPA Acrylates Copolymer, PPG-26-Buteth-26, PEG-40 Hydrogenated Castor Oil, Hydroxyethlcellulose, Methylparaben, DMDM Hydantoin, Fragrance, Red 40, Yellow 5

Incoming search terms:

  • Maxius Maxiglide XP Straightening Iron

Related posts:

  1. Healthy hair straightening PART 1
  2. Healthy hair straightening PART 2
  3. Tutorial: Hair Straightening [Part 1 of 2]
  4. How to Straighten Curly Hair : Tips for Straightening Hair
  5. Super Straight Shiny Hair – Straightening Comb

Tagged with: BeyondflathairhealthyironMaxiglideMaxiusnaturalrecommendationreviewshineysleeksteamstraightstraightenerXP

Filed under: hair straightening products

Like this post? Subscribe to my RSS feed and get loads more!